Options
All
  • Public
  • Public/Protected
  • All
Menu

Hierarchy

  • EntityPoly

Index

Properties

__typename?: "EntityPoly"
nstd_linkage?: <internal>.Maybe<string>

A flag to indicate whether the polymer contains at least one monomer-to-monomer link different from that implied by _entity_poly.type.

Allowable values: n, no, y, yes

nstd_monomer?: <internal>.Maybe<string>

A flag to indicate whether the polymer contains at least one monomer that is not considered standard.

Allowable values: n, no, y, yes

pdbx_seq_one_letter_code?: <internal>.Maybe<string>

Sequence of protein or nucleic acid polymer in standard one-letter codes of amino acids or nucleotides. Non-standard amino acids/nucleotides are represented by their Chemical Component Dictionary (CCD) codes in parenthesis. Deoxynucleotides are represented by the specially-assigned 2-letter CCD codes in parenthesis, with 'D' prefix added to their ribonucleotide counterparts. For hybrid polymer, each residue is represented by the code of its individual type. A cyclic polymer is represented in linear sequence from the chosen start to end.

A for Alanine or Adenosine-5'-monophosphate C for Cysteine or Cytidine-5'-monophosphate D for Aspartic acid E for Glutamic acid F for Phenylalanine G for Glycine or Guanosine-5'-monophosphate H for Histidine I for Isoleucine or Inosinic Acid L for Leucine K for Lysine M for Methionine N for Asparagine or Unknown ribonucleotide O for Pyrrolysine P for Proline Q for Glutamine R for Arginine S for Serine T for Threonine U for Selenocysteine or Uridine-5'-monophosphate V for Valine W for Tryptophan Y for Tyrosine (DA) for 2'-deoxyadenosine-5'-monophosphate (DC) for 2'-deoxycytidine-5'-monophosphate (DG) for 2'-deoxyguanosine-5'-monophosphate (DT) for Thymidine-5'-monophosphate (MSE) for Selenomethionine (SEP) for Phosphoserine (PTO) for Phosphothreonine (PTR) for Phosphotyrosine (PCA) for Pyroglutamic acid (UNK) for Unknown amino acid (ACE) for Acetylation cap (NH2) for Amidation cap

Examples: HHHH(MSE)AKQRSG or AUCGGAAU, (MSE)SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD

pdbx_seq_one_letter_code_can?: <internal>.Maybe<string>

Canonical sequence of protein or nucleic acid polymer in standard one-letter codes of amino acids or nucleotides, corresponding to the sequence in _entity_poly.pdbx_seq_one_letter_code. Non-standard amino acids/nucleotides are represented by the codes of their parents if parent is specified in _chem_comp.mon_nstd_parent_comp_id, or by letter 'X' if parent is not specified. Deoxynucleotides are represented by their canonical one-letter codes of A, C, G, or T.

Examples: MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD

pdbx_strand_id?: <internal>.Maybe<string>

The PDB strand/chain id(s) corresponding to this polymer entity.

Examples: A,B, A, B, A,B,C

pdbx_target_identifier?: <internal>.Maybe<string>

For Structural Genomics entries, the sequence's target identifier registered at the TargetTrack database.

Examples: JCSG-11211, 356560

rcsb_artifact_monomer_count?: <internal>.Maybe<number>

Number of regions in the sample sequence identified as expression tags, linkers, or cloning artifacts.

rcsb_conflict_count?: <internal>.Maybe<number>

Number of monomer conflicts relative to the reference sequence.

rcsb_deletion_count?: <internal>.Maybe<number>

Number of monomer deletions relative to the reference sequence.

rcsb_entity_polymer_type?: <internal>.Maybe<string>

A coarse-grained polymer entity type.

Allowable values: DNA, NA-hybrid, Other, Protein, RNA

rcsb_insertion_count?: <internal>.Maybe<number>

Number of monomer insertions relative to the reference sequence.

rcsb_mutation_count?: <internal>.Maybe<number>

Number of engineered mutations engineered in the sample sequence.

rcsb_non_std_monomer_count?: <internal>.Maybe<number>

Number of non-standard monomers in the sample sequence.

rcsb_non_std_monomers?: <internal>.Maybe<<internal>.Maybe<string>[]>

Unique list of non-standard monomer chemical component identifiers in the sample sequence.

rcsb_prd_id?: <internal>.Maybe<string>

For polymer BIRD molecules the BIRD identifier for the entity.

rcsb_sample_sequence_length?: <internal>.Maybe<number>

The monomer length of the sample sequence.

type?: <internal>.Maybe<string>

The type of the polymer.

Allowable values: cyclic-pseudo-peptide, other, peptide nucleic acid, polydeoxyribonucleotide, polydeoxyribonucleotide/polyribonucleotide hybrid, polypeptide(D), polypeptide(L), polyribonucleotide

Generated using TypeDoc